PPP3CC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431794	Novus Biologicals NBP18665625UL	25 μL
NBP186656	Novus Biologicals NBP186656	0.1 mL

Description

PPP3CC Polyclonal specifically detects PPP3CC in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP3CC
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5533
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
• Gene Symbols: PPP3CC
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only