PRAS40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257165

Catalog No. NBP257165

Description

PRAS40 Polyclonal specifically detects PRAS40 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRAS40
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 40 kDa, AKT1 substrate 1 (proline-rich), MGC2865, proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AKT1S1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
• Quantity: 100 μL
• Research Discipline: Apoptosis, Autophagy, Cancer, Growth and Development, Lipid and Metabolism, mTOR Pathway, Neuronal Cell Markers, Neuroscience, Tumor Suppressors
• Gene ID (Entrez): 84335
• Target Species: Human
• Isotype: IgG

For Research Use Only