Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRDM10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169671 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169671 25 μg
NB169670 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB169671 Supplier Novus Biologicals Supplier No. NBP31729725UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PRDM10 Polyclonal antibody specifically detects PRDM10 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen PRDM10
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias KIAA1231PRDM zinc finger transcription factor, MGC131802, PFM7tristanin, PR domain containing 10, PR domain zinc finger protein 10, PR domain-containing protein 10, PR-domain family member 7, TRIS, Tristanin
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Chromatin Research
Primary or Secondary Primary
Gene ID (Entrez) 56980
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.