PRG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP188573

Catalog No. NBP188573

Description

PRG2 Polyclonal specifically detects PRG2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRG2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Accession No.: P13727
• Gene Symbols: PRG2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC
• Quantity: 0.1 mL
• Research Discipline: Asthma, Immunology
• Gene ID (Entrez): 5553
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BMPGeosinophil major basic protein, bone marrow proteoglycan, bone-marrow proteoglycan, MBP1, MBPeosinophil granule major basic protein, MGC14537, natural killer cell activator, Proteoglycan 2, proteoglycan 2 preproprotein, proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only