PRG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB431252	Novus Biologicals NBP18857325UL	25 μL
NBP188573	Novus Biologicals NBP188573	0.1 mL

Description

PRG2 Polyclonal specifically detects PRG2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRG2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P13727
• Gene ID (Entrez): 5553
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Asthma, Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BMPGeosinophil major basic protein, bone marrow proteoglycan, bone-marrow proteoglycan, MBP1, MBPeosinophil granule major basic protein, MGC14537, natural killer cell activator, Proteoglycan 2, proteoglycan 2 preproprotein, proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)
• Gene Symbols: PRG2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only