PRKCSH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23849225UL

Catalog No. NB396801

Description

PRKCSH Polyclonal specifically detects PRKCSH in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRKCSH
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: P14314
• Gene Symbols: PRKCSH
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SPAEEDKMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPK
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5589
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AGE-R2,80K-H protein, G19P1AGE-binding receptor 2, glucosidase 2 subunit beta, Glucosidase II subunit beta, glucosidase II, beta subunit, hepatocystin, PCLD, PKCSH, PLD1, Protein kinase C substrate 60.1 kDa protein heavy chain, protein kinase C substrate 80K-H, protein kinase C substrate, 80 Kda protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.