Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301123

PRKRIR Antibody, Novus Biologicals™
SDP

Catalog No. NB301123 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301123 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301123 Supplier Novus Biologicals Supplier No. NBP325329
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PRKRIR Polyclonal antibody specifically detects PRKRIR in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen PRKRIR
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 58 kDa interferon-induced protein kinase-interacting protein, DAP452 kDa repressor of the inhibitor of the protein kinase, Death-associated protein 4, inhibitor of protein kinase PKR, MGC102750, p52rIPK, p58IPK-interacting protein, protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor), THAP domain-containing protein 0, THAP0
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein PRKRIR using the following amino acid sequence: SSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLC
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5612
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.