Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP152944

PRMT2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP152944 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152944 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152944 Supplier Novus Biologicals Supplier No. NBP152944
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PRMT2 Polyclonal antibody specifically detects PRMT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen PRMT2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P55345
Gene Alias EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT2, HMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae), HRMT1L1PRMT2 beta, MGC111373, PRMT2 alpha, PRMT2 gamma, protein arginine methyltransferase 2, protein arginine N-methyltransferase 2
Gene Symbols PRMT2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PRMT2 (protein arginine methyltransferase 2) The peptide sequence was selected from the N terminal of PRMT2 (NP_001526). Peptide sequence ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL.
Molecular Weight of Antigen 48 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Chromatin Research
Primary or Secondary Primary
Gene ID (Entrez) 3275
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.