Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PRMT3 Antibody, Novus Biologicals™

PRMT3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155399 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155399 100 μL
NBP15539920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155399 Supplier Novus Biologicals Supplier No. NBP155399
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PRMT3 Polyclonal specifically detects PRMT3 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

Antigen PRMT3
Applications Western Blot, ChIP Assay
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP)
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O60678
Gene Alias EC 2.1.1, EC 2.1.1.-, heterogeneous nuclear ribonucleoprotein methyltransferase-like 3, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, HMT1 hnRNP methyltransferase-like 3, HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae), HRMT1L3, protein arginine methyltransferase 3, protein arginine N-methyltransferase 3
Gene Symbols PRMT3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PRMT3(protein arginine methyltransferase 3) The peptide sequence was selected from the middle region of PRMT3. Peptide sequence LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK.
Molecular Weight of Antigen 60 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Chromatin Research, Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10196
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.