PRMT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25604125UL

Catalog No. NB435517

Description

PRMT5 Polyclonal specifically detects PRMT5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PRMT5
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT5, HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein, HRMT1L5, IBP72, Jak-binding protein 1, JBP1, protein arginine methyltransferase 5, protein arginine N-methyltransferase 5, Shk1 kinase-binding protein 1 homolog, SKB1, skb1 (S. pombe) homolog, SKB1 homolog (S. pombe), SKB1HsSKB1 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PRMT5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENA
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Chromatin Research, Circadian Rhythm
• Gene ID (Entrez): 10419
• Target Species: Human
• Isotype: IgG

For Research Use Only