Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRMT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	PRMT5
Dilution	Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP256041 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP256041	100 μL	Each for $610.00	Only null left	Sign In or Register to check your price. Add to Cart

NB435517 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25604125UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

PRMT5 Polyclonal specifically detects PRMT5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	PRMT5
Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	10419
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENA
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, Chromatin Research, Circadian Rhythm
Gene Alias	EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT5, HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein, HRMT1L5, IBP72, Jak-binding protein 1, JBP1, protein arginine methyltransferase 5, protein arginine N-methyltransferase 5, Shk1 kinase-binding protein 1 homolog, SKB1, skb1 (S. pombe) homolog, SKB1 homolog (S. pombe), SKB1HsSKB1 homolog
Gene Symbols	PRMT5
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PRMT5 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents