Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRMT8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155401 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155401 100 μL
NBP1554020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155401 Supplier Novus Biologicals Supplier No. NBP155401
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PRMT8 Polyclonal specifically detects PRMT8 in Human samples. It is validated for Western Blot.

Specifications

Antigen PRMT8
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NR22
Gene Alias EC 2.1.1, EC 2.1.1.-, EC 2.1.1.77, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4, HMT1 hnRNP methyltransferase-like 3, HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae), HMT1 hnRNP methyltransferase-like 4, HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae), HRMT1L3, HRMT1L4, protein arginine methyltransferase 8, protein arginine N-methyltransferase 4, protein arginine N-methyltransferase 8
Gene Symbols PRMT8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND.
Molecular Weight of Antigen 43 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56341
Reconstitution Reconstitute with 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.