Prokineticin R2/PROKR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192290

Catalog No. NBP192290

Description

Prokineticin R2/PROKR2 Polyclonal specifically detects Prokineticin R2/PROKR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Prokineticin R2/PROKR2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: dJ680N4.3, G protein-coupled receptor 73-like 1, GPR73bG-protein coupled receptor 73-like 1, GPR73L1Kallmann syndrome 3 (autosomal dominant), GPRg2KAL3, PKR2PK-R2, prokineticin receptor 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PROKR2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
• Quantity: 0.1 mL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 128674
• Target Species: Human
• Isotype: IgG

For Research Use Only