Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Prostaglandin I2 Synthase Antibody, Novus Biologicals™
SDP

Catalog No. NBP16239020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16239020 20 μL
NBP162390 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16239020 Supplier Novus Biologicals Supplier No. NBP16239020UL

Rabbit Polyclonal Antibody

Prostaglandin I2 Synthase Polyclonal specifically detects Prostaglandin I2 Synthase in Human samples. It is validated for Western Blot.

Specifications

Antigen Prostaglandin I2 Synthase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q16647
Gene Alias CYP8A1PTGI, CYP8prostacyclin synthase, EC 5.3.99.4, MGC126858, MGC126860, PGIScytochrome P450, family 8, subfamily A, polypeptide 1, prostaglandin I2 (prostacyclin) synthase, Prostaglandin I2 synthase
Gene Symbols PTGIS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS.
Molecular Weight of Antigen 57 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5740
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.