Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Prostaglandin I2 Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16239020UL
Description
Prostaglandin I2 Synthase Polyclonal specifically detects Prostaglandin I2 Synthase in Human samples. It is validated for Western Blot.Specifications
| Prostaglandin I2 Synthase | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| Q16647 | |
| PTGIS | |
| Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS. | |
| Affinity Purified | |
| RUO | |
| 5740 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CYP8A1PTGI, CYP8prostacyclin synthase, EC 5.3.99.4, MGC126858, MGC126860, PGIScytochrome P450, family 8, subfamily A, polypeptide 1, prostaglandin I2 (prostacyclin) synthase, Prostaglandin I2 synthase | |
| Rabbit | |
| 57 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction