Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Prosurfactant Protein C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $379.00


Antigen Prosurfactant Protein C
Immunogen Synthetic peptides corresponding to SFTPC(surfactant, pulmonary-associated protein C) The peptide sequence was selected from the N terminal of SFTPC. Peptide sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1601720 View Documents Novus BiologicalsSupplier Diversity Partner
20 ul Each for $149.00
Add to cart
NBP160117 View Documents Novus BiologicalsSupplier Diversity Partner
100 ul Each for $379.00
Add to cart


Prosurfactant Protein C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.


Prosurfactant Protein C
Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Synthetic peptides corresponding to SFTPC(surfactant, pulmonary-associated protein C) The peptide sequence was selected from the N terminal of SFTPC. Peptide sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI.
PSP-C, pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SFTP2, SFTP2pulmonary surfactant apoprotein-2 SP-C, SMDP2surfactant, pulmonary-associated protein C, SP-CSP5, surfactant protein C
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit