Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Proteasome 20S alpha 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Proteasome 20S alpha 3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154374 View Documents View Product Certificates	Novus Biologicals NBP154374	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Proteasome 20S alpha 3 Polyclonal specifically detects Proteasome 20S alpha 3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Proteasome 20S alpha 3
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Gene Alias	EC 3.4.25.1, HC8MGC32631, Macropain subunit C8, MGC12306, Multicatalytic endopeptidase complex subunit C8, proteasome (prosome, macropain) subunit, alpha type, 3, Proteasome component C8, proteasome subunit alpha type-3, proteasome subunit C8, PSC3, PSC8
Gene Symbols	PSMA3
Isotype	IgG
Test Specificity	This product is specific to Subunit or Isoform: alpha type-3.

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P25788-2
Gene ID (Entrez)	5684
Immunogen	Synthetic peptides corresponding to PSMA3(proteasome (prosome, macropain) subunit, alpha type, 3) The peptide sequence was selected from the middle region of PSMA3. Peptide sequence VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN.
Primary or Secondary	Primary
Molecular Weight of Antigen	28 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Proteasome 20S alpha 3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents