Proteasome 20S alpha 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156843

Catalog No. NBP156843

Description

Proteasome 20S alpha 5 Polyclonal specifically detects Proteasome 20S alpha 5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Proteasome 20S alpha 5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.25.1, FLJ42315, macropain subunit zeta, Macropain zeta chain, MGC117302, MGC125802, MGC125803, MGC125804, Multicatalytic endopeptidase complex zeta chain, proteasome (prosome, macropain) subunit, alpha type, 5, proteasome alpha 5 subunit, proteasome component 5, proteasome subunit alpha type-5, proteasome subunit zeta, Proteasome zeta chain, PSC5, ZETA
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 5686
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P28066
• Gene Symbols: PSMA5
• Immunogen: Synthetic peptides corresponding to PSMA5(proteasome (prosome, macropain) subunit, alpha type, 5) The peptide sequence was selected from the N terminal of PSMA5 (NP_002781). Peptide sequence MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha type-5.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG