Proteasome 20S beta 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156575

Catalog No. NBP156575

Description

Proteasome 20S beta 6 Polyclonal specifically detects Proteasome 20S beta 6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Proteasome 20S beta 6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta type-6.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P28072
• Gene Symbols: PSMB6
• Immunogen: Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 5694
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.