Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Proteasome 20S beta 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15657520UL
Description
Proteasome 20S beta 6 Polyclonal specifically detects Proteasome 20S beta 6 in Human, Mouse samples. It is validated for Western Blot.Specifications
Proteasome 20S beta 6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P28072 | |
PSMB6 | |
Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA. | |
20 μL | |
Core ESC Like Genes, Stem Cell Markers | |
5694 | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
This product is specific to Subunit or Isoform: beta type-6. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction