Proteasome 20S beta2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154590

Catalog No. NBP154590

Description

Proteasome 20S beta2 Polyclonal specifically detects Proteasome 20S beta2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Proteasome 20S beta2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.25.1, HC7-I, Macropain subunit C7-I, MGC104215, MGC126885, multicatalytic endopeptidase complex subunit C7-1, Multicatalytic endopeptidase complex subunit C7-I, proteasome (prosome, macropain) subunit, beta type, 2, proteasome beta 2 subunit, Proteasome component C7-I, proteasome subunit beta type-2, proteasome subunit, beta type, 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 5690
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P49721
• Gene Symbols: PSMB2
• Immunogen: Synthetic peptides corresponding to PSMB2(proteasome (prosome, macropain) subunit, beta type, 2) The peptide sequence was selected from the middle region of PSMB2 (NP_002785). Peptide sequence LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta type-2.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG