Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Proteasome 20S beta2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Proteasome 20S beta2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15459020
|
Novus Biologicals
NBP15459020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP154590
|
Novus Biologicals
NBP154590 |
100 μL |
Each for $487.50
|
|
|||||
Description
Proteasome 20S beta2 Polyclonal specifically detects Proteasome 20S beta2 in Human samples. It is validated for Western Blot.Specifications
| Proteasome 20S beta2 | |
| Polyclonal | |
| Rabbit | |
| P49721 | |
| 5690 | |
| Synthetic peptides corresponding to PSMB2(proteasome (prosome, macropain) subunit, beta type, 2) The peptide sequence was selected from the middle region of PSMB2 (NP_002785). Peptide sequence LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD. | |
| Primary | |
| 23 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.25.1, HC7-I, Macropain subunit C7-I, MGC104215, MGC126885, multicatalytic endopeptidase complex subunit C7-1, Multicatalytic endopeptidase complex subunit C7-I, proteasome (prosome, macropain) subunit, beta type, 2, proteasome beta 2 subunit, Proteasome component C7-I, proteasome subunit beta type-2, proteasome subunit, beta type, 2 | |
| PSMB2 | |
| IgG | |
| This product is specific to Subunit or Isoform: beta type-2. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title