Protein Kinase A regulatory subunit I alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233585

Catalog No. NBP233585

Description

Protein Kinase A regulatory subunit I alpha Polyclonal specifically detects Protein Kinase A regulatory subunit I alpha in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Protein Kinase A regulatory subunit I alpha
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Simple Western 4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P10644
• Gene Symbols: PRKAR1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 5573
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cAMP-dependent protein kinase regulatory subunit RIalpha, cAMP-dependent protein kinase type I-alpha regulatory chain, cAMP-dependent protein kinase type I-alpha regulatory subunit, CAR, CNC, CNC1, MGC17251, PKA R1 alpha, PKA1, PKR1, PPNAD1, PRKAR1, protein kinase A type 1a regulatory subunit, protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1), Tissue-specific extinguisher 1, TSE1DKFZp779L0468
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only