Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protein Kinase A regulatory subunit I alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$610.00
Specifications
Antigen | Protein Kinase A regulatory subunit I alpha |
---|---|
Dilution | Western Blot 0.4 ug/ml, Simple Western 4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Protein Kinase A regulatory subunit I alpha Polyclonal specifically detects Protein Kinase A regulatory subunit I alpha in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Protein Kinase A regulatory subunit I alpha | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P10644 | |
5573 | |
This antibody was developed against a recombinant protein corresponding to amino acids: MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Simple Western 4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Cancer | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
cAMP-dependent protein kinase regulatory subunit RIalpha, cAMP-dependent protein kinase type I-alpha regulatory chain, cAMP-dependent protein kinase type I-alpha regulatory subunit, CAR, CNC, CNC1, MGC17251, PKA R1 alpha, PKA1, PKR1, PPNAD1, PRKAR1, protein kinase A type 1a regulatory subunit, protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1), Tissue-specific extinguisher 1, TSE1DKFZp779L0468 | |
PRKAR1A | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title