Protein kinase-like protein SgK493 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18075625UL

Catalog No. NB407409

Description

Protein kinase-like protein SgK493 Polyclonal specifically detects Protein kinase-like protein SgK493 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Protein kinase-like protein SgK493
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q504Y2
• Gene Symbols: PKDCC
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQ
• Quantity: 25ul
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 91461
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7, FLJ18197, MGC125960, protein kinase domain containing, cytoplasmic homolog (mouse), protein kinase domain-containing protein, cytoplasmic, Protein kinase-like protein SgK493, SgK493, Sugen kinase 493, Vertebrate lonesome kinase, Vlk
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only