Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protein O-Fucosyltransferase 1/POFUT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16919620UL
Description
Protein O-Fucosyltransferase 1/POFUT1 Polyclonal specifically detects Protein O-Fucosyltransferase 1/POFUT1 in Human samples. It is validated for Western Blot.Specifications
Protein O-Fucosyltransferase 1/POFUT1 | |
Polyclonal | |
Western Blot | |
Q6EV69 | |
POFUT1 | |
Synthetic peptides corresponding to POFUT1 (protein O-fucosyltransferase 1) The peptide sequence was selected form the middle region of POFUT1. Peptide sequence RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP. | |
20 μL | |
Signal Transduction | |
23509 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction