Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16919620

Protein O-Fucosyltransferase 1/POFUT1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16919620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16919620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16919620 Supplier Novus Biologicals Supplier No. NBP16919620UL

Description

Rabbit Polyclonal Antibody

Protein O-Fucosyltransferase 1/POFUT1 Polyclonal specifically detects Protein O-Fucosyltransferase 1/POFUT1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Protein O-Fucosyltransferase 1/POFUT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6EV69
Gene Alias FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1
Gene Symbols POFUT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to POFUT1 (protein O-fucosyltransferase 1) The peptide sequence was selected form the middle region of POFUT1. Peptide sequence RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23509
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.