Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody, Novus Biologicals™

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody, Novus Biologicals™
SDP

Catalog No. NB392984 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392984 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392984 Supplier Novus Biologicals Supplier No. NBP26863325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Polyclonal specifically detects Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.

Specifications

Antigen Protein O-Glucosyltransferase 1/POGLUT1/KTELC1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias 9630046K23Rik, C3orf9, CAP10-like protein, 46 kDa, chromosome 3 open reading frame 9, CLP46, EC 2.4.1.-, hCLP46CAP10-like 46 kDa protein, KDELC family like 1, KDELCL1, KTEL (Lys-Tyr-Glu-Leu) containing 1, KTEL motif-containing protein 1, MDS010, MDSRPKTELC1, MGC32995, Myelodysplastic syndromes relative protein, protein O-glucosyltransferase 1, Rumi, x 010 protein
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFIL
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Developmental Biology
Primary or Secondary Primary
Gene ID (Entrez) 56983
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.