Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protein phosphatase 1 inhibitor 3D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18723525UL
Description
Protein phosphatase 1 inhibitor 3D Polyclonal specifically detects Protein phosphatase 1 inhibitor 3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Protein phosphatase 1 inhibitor 3D | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
DKFZp781L2441, PP1 subunit R6, PPP1R6, protein phosphatase 1 regulatory subunit 3D, protein phosphatase 1 regulatory subunit 6, protein phosphatase 1, regulatory subunit 3D, protein phosphatase 1, regulatory subunit 6, spinophilin, protein phosphatase 1-binding subunit R6, regulatory (inhibitor) subunit 3D | |
Rabbit | |
Affinity Purified | |
RUO | |
5509 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PPP1R3D | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction