Protein phosphatase 1 inhibitor 3D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187235

Catalog No. NBP187235

Description

Protein phosphatase 1 inhibitor 3D Polyclonal specifically detects Protein phosphatase 1 inhibitor 3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Protein phosphatase 1 inhibitor 3D
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: DKFZp781L2441, PP1 subunit R6, PPP1R6, protein phosphatase 1 regulatory subunit 3D, protein phosphatase 1 regulatory subunit 6, protein phosphatase 1, regulatory subunit 3D, protein phosphatase 1, regulatory subunit 6, spinophilin, protein phosphatase 1-binding subunit R6, regulatory (inhibitor) subunit 3D
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5509
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP1R3D
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only