Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Protein S/PROS1 Antibody, Novus Biologicals™

Protein S/PROS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15916520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15916520 20 μL
NBP159165 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15916520 Supplier Novus Biologicals Supplier No. NBP15916520UL

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Protein S/PROS1 Polyclonal specifically detects Protein S/PROS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Protein S/PROS1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P07225
Gene Alias EC 3.4.21, PROS, protein S (alpha), protein Sa, PS21, PS22, PS23, PS24, PS25, PSA, vitamin K-dependent plasma protein S, vitamin K-dependent protein S
Gene Symbols PROS1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PROS1(protein S (alpha)) The peptide sequence was selected from the middle region of PROS1 (NP_000304). Peptide sequence MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL.
Molecular Weight of Antigen 76 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5627
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.