Protocadherin alpha 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159253

Catalog No. NBP159253

Description

Protocadherin alpha 4 Polyclonal specifically detects Protocadherin alpha 4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Protocadherin alpha 4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PCDHA4
• Immunogen: Synthetic peptides corresponding to PCDHA4(protocadherin alpha 4) The peptide sequence was selected from the N terminal of PCDHA4. Peptide sequence VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 92%; Canine: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CNR1, CNRN1, CRNR1, KIAA0345-like 10, MGC138307, MGC142169, ortholog of mouse CNR1, PCDH-alpha-4, PCDH-ALPHA4, protocadherin alpha 4, protocadherin alpha-4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56144
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.