Protocadherin gamma C3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257770

Catalog No. NBP257770

Description

Protocadherin gamma C3 Polyclonal specifically detects Protocadherin gamma C3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Protocadherin gamma C3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: cadherin-like 2, PC43, PC-43, PCDH2, PCDH-GAMMA-C3, protocadherin 2, protocadherin 43, protocadherin gamma subfamily C, 3, protocadherin gamma-C3, protocadherin-2, Protocadherin-43
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5098
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PCDHGC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only