Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRP19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23838125UL
Description
PRP19 Polyclonal specifically detects PRP19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
PRP19 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9UMS4 | |
PRPF19 | |
This antibody was developed against a recombinant protein corresponding to amino acids: VPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQI | |
25 μL | |
Apoptosis, Cancer, DNA Repair, GPCR, Tumor Suppressors | |
27339 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
hPSO4, NMP200SNEV, Nuclear matrix protein 200, nuclear matrix protein NMP200 related to splicing factor PRP19, pre-mRNA-processing factor 19, PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), PRP19PRP19/PSO4 homolog (S. cerevisiae), PSO4PRP19/PSO4 homolog, Senescence evasion factor, UBOX4 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction