PRP19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23838125UL

Catalog No. NB396856

Description

PRP19 Polyclonal specifically detects PRP19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: PRP19
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9UMS4
• Gene Symbols: PRPF19
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQI
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, DNA Repair, GPCR, Tumor Suppressors
• Gene ID (Entrez): 27339
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: hPSO4, NMP200SNEV, Nuclear matrix protein 200, nuclear matrix protein NMP200 related to splicing factor PRP19, pre-mRNA-processing factor 19, PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), PRP19PRP19/PSO4 homolog (S. cerevisiae), PSO4PRP19/PSO4 homolog, Senescence evasion factor, UBOX4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.