PrPC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23850825UL

Catalog No. NB396793

Description

PrPC Polyclonal specifically detects PrPC in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Prion protein
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P04156
• Gene Symbols: PRNP
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKP
• Quantity: 25 μL
• Research Discipline: Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 5621
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD230, CJD, fatal familial insomnia), GSS, prion protein, prion protein (p27-30), prion protein PrP, prion-related protein, PRIPMGC26679
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.