Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PRPF3 Antibody, Novus Biologicals™

PRPF3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP183219 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP183219 0.1 mL
NB433107 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP183219 Supplier Novus Biologicals Supplier No. NBP183219
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PRPF3 Polyclonal specifically detects PRPF3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PRPF3
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias hPrp3, HPRP3P, HPRP3retinitis pigmentosa 18 (autosomal dominant), Pre-mRNA-splicing factor 3, PRP3, PRP3 pre-mRNA processing factor 3 homolog (S. cerevisiae), PRP3 pre-mRNA processing factor 3 homolog (yeast), Prp3p, RP18, U4/U6 small nuclear ribonucleoprotein Prp3, U4/U6 snRNP 90 kDa protein, U4/U6-associated RNA splicing factor
Gene Symbols PRPF3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:WWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 9129
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.