Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PRPS2 Antibody, Novus Biologicals™

PRPS2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15766920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15766920 20 μL
NBP157669 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15766920 Supplier Novus Biologicals Supplier No. NBP15766920UL

Description

Rabbit Polyclonal Antibody

PRPS2 Polyclonal specifically detects PRPS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PRPS2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P11908
Gene Alias EC 2.7.6.1, Phosphoribosyl pyrophosphate synthase II, phosphoribosyl pyrophosphate synthetase 2, PPRibP, PPRibP synthetase, PRSII, PRS-II, ribose-phosphate diphosphokinase 2, ribose-phosphate pyrophosphokinase 2
Gene Symbols PRPS2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PRPS2(phosphoribosyl pyrophosphate synthetase 2) The peptide sequence was selected from the middle region of PRPS2. Peptide sequence VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 5634
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.