Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRR5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157688
Description
PRR5L Polyclonal specifically detects PRR5L in Human samples. It is validated for Western Blot.Specifications
PRR5L | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
FLJ14213MGC16218, FLJ22630, proline rich 5 like, Protein observed with Rictor-2, protor-2, PROTOR2proline-rich protein 5-like | |
Rabbit | |
Protein A purified | |
RUO | |
79899 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6MZQ0 | |
PRR5L | |
Synthetic peptides corresponding to FLJ14213(hypothetical protein FLJ14213) The peptide sequence was selected from the N terminal of FLJ14213. Peptide sequence SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Rat: 100%; Mouse: 100%; Bovine: 100%; Canine: 100%; Human: 100%; Chicken: 85%; Green puffer: 78%;. | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction