PSD3 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP155339	100 μL

Catalog No. NBP155339 Supplier Novus Biologicals Supplier No. NBP155339

Description

Rabbit Polyclonal Antibody

PSD3 Polyclonal specifically detects PSD3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSD3
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9NYI0-3
• Gene Alias: ADP-ribosylation factor guanine nucleotide factor 6, DKFZp761K1423, EFA6RHepatocellular carcinoma-associated antigen 67, Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6, HCA67Pleckstrin homology and SEC7 domain-containing protein 3, KIAA0942, PH and SEC7 domain-containing protein 3, pleckstrin and Sec7 domain containing 3
• Gene Symbols: PSD3
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to PSD3(pleckstrin and Sec7 domain containing 3) The peptide sequence was selected from the middle region of PSD3. Peptide sequence SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ.
• Molecular Weight of Antigen: 56 kDa
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23362
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG

For Research Use Only