Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSG3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1554920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1554920 20 μL
NBP155491 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1554920 Supplier Novus Biologicals Supplier No. NBP15549120UL

Rabbit Polyclonal Antibody

PSG3 Polyclonal specifically detects PSG3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PSG3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias Carcinoembryonic antigen SG5, pregnancy specific beta-1-glycoprotein 3, pregnancy-specific beta-1-glycoprotein 3, Pregnancy-specific glycoprotein 3, PS-beta-G-3, PSBG-3
Gene Symbols PSG3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PSG3(pregnancy specific beta-1-glycoprotein 3) The peptide sequence was selected from the N terminal of PSG3. Peptide sequence VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS.
Molecular Weight of Antigen 16 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5671
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.