PSMA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154633

Catalog No. NBP154633

Description

PSMA2 Polyclonal specifically detects PSMA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Proteasome 20S alpha 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.25.1, HC3PSC2, Macropain subunit C3, MU, Multicatalytic endopeptidase complex subunit C3, PMSA2, proteasome (prosome, macropain) subunit, alpha type, 2, Proteasome component C3, proteasome subunit alpha type-2, proteasome subunit HC3, PSC3
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 5683
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: P25787
• Gene Symbols: PSMA2
• Immunogen: Synthetic peptides corresponding to PSMA2(proteasome (prosome, macropain) subunit, alpha type, 2) The peptide sequence was selected from the N terminal of PSMA2 (NP_002778), Peptide sequence VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha type-2.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG