PSMA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23875425UL

Catalog No. NB396686

Description

PSMA4 Polyclonal specifically detects PSMA4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMA4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P25789
• Gene Symbols: PSMA4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
• Quantity: 25 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 5685
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: HC9EC 3.4.25.1, HsT17706, Macropain subunit C9, MGC12467, MGC24813, Multicatalytic endopeptidase complex subunit C9, proteasome (prosome, macropain) subunit, alpha type, 4, Proteasome component C9, proteasome subunit alpha type-4, proteasome subunit HC9, Proteasome subunit L, PSC9MGC111191
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.