PSMB5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154593

Catalog No. NBP154593

Description

PSMB5 Polyclonal specifically detects PSMB5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PSMB5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: LMPXproteasome beta 5 subunit, Macropain epsilon chain, MB1EC 3.4.25.1, Multicatalytic endopeptidase complex epsilon chain, proteasome (prosome, macropain) subunit, beta type, 5, proteasome catalytic subunit 3, Proteasome chain 6, Proteasome epsilon chain, proteasome subunit beta type-5, Proteasome subunit MB1, Proteasome subunit X, proteasome subunit, beta type, 5, PSX large multifunctional protease X, XMGC104214
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 5693
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P28074
• Gene Symbols: PSMB5
• Immunogen: Synthetic peptides corresponding to PSMB5(proteasome (prosome, macropain) subunit, beta type, 5) The peptide sequence was selected from the middle region of PSMB5. Peptide sequence IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta type-5.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

For Research Use Only