PSMC3IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179237

Catalog No. NBP179237

Description

PSMC3IP Polyclonal specifically detects PSMC3IP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PSMC3IP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DBD-interacting, GT198, GT198 alternative, homologous-pairing protein 2 homolog, HOP2, HUMGT198A, Nuclear receptor coactivator GT198, Proteasome 26S ATPase subunit 3-interacting protein, PSMC3 interacting protein, Tat-binding protein 1-interacting protein, TBP-1 interacting protein, TBP-1-interacting protein, TBPIPPSMC3-interacting protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29893
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057640
• Gene Symbols: PSMC3IP
• Immunogen: Synthetic peptide directed towards the middle region of human PSMC3IPThe immunogen for this antibody is PSMC3IP. Peptide sequence RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Bovine: 92%; Rat: 92%; Goat: 85%; Mouse: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Form: Purified