PSMC3IP Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP179237	100 μL

Catalog No. NBP179237 Supplier Novus Biologicals Supplier No. NBP179237

Description

Rabbit Polyclonal Antibody

PSMC3IP Polyclonal specifically detects PSMC3IP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PSMC3IP
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: NP_057640
• Gene Alias: DBD-interacting, GT198, GT198 alternative, homologous-pairing protein 2 homolog, HOP2, HUMGT198A, Nuclear receptor coactivator GT198, Proteasome 26S ATPase subunit 3-interacting protein, PSMC3 interacting protein, Tat-binding protein 1-interacting protein, TBP-1 interacting protein, TBP-1-interacting protein, TBPIPPSMC3-interacting protein
• Gene Symbols: PSMC3IP
• Host Species: Rabbit
• Immunogen: Synthetic peptide directed towards the middle region of human PSMC3IPThe immunogen for this antibody is PSMC3IP. Peptide sequence RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP.
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 29893
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Bovine: 92%; Rat: 92%; Goat: 85%; Mouse: 85%; Rabbit: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG

For Research Use Only