PSMD11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255793

Catalog No. NBP255793

Description

PSMD11 Polyclonal specifically detects PSMD11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMD11
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: MGC3844,26S proteasome regulatory subunit RPN6, p44.5,26S proteasome regulatory subunit 9, proteasome (prosome, macropain) 26S subunit, non-ATPase, 11,26S proteasome regulatory subunit p44.5, Rpn6,26S proteasome regulatory subunit S9, S9,26S proteasome non-ATPase regulatory subunit 11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5717
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PSMD11
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only