PSMD13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23842625UL

Catalog No. NB396832

Description

PSMD13 Polyclonal specifically detects PSMD13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMD13
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9UNM6
• Gene Symbols: PSMD13
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: HSPC027,26S proteasome regulatory subunit RPN9, p40.5,26S proteasome subunit p40.5,26S proteasome regulatory subunit p40.5, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13,26S proteasome regulatory subunit S11, Rpn9,26S proteasome non-ATPase regulatory subunit 13, S11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5719
• Target Species: Human
• Isotype: IgG