PSMD7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23861225UL

Catalog No. NB436159

Description

PSMD7 Polyclonal specifically detects PSMD7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMD7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P51665
• Gene Symbols: PSMD7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 26S proteasome non-ATPase regulatory subunit 7, 26S proteasome regulatory subunit RPN8, Moloney leukemia virus-34 proviral integration, Mov34 homolog, Mov34 protein homolog, MOV3426S proteasome regulatory subunit S12, MOV34L, P40, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog), Proteasome subunit p40, Rpn8, S12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5713
• Target Species: Human
• Isotype: IgG