Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMD7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | PSMD7 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PSMD7 Polyclonal specifically detects PSMD7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PSMD7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P51665 | |
| 5713 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26S proteasome non-ATPase regulatory subunit 7, 26S proteasome regulatory subunit RPN8, Moloney leukemia virus-34 proviral integration, Mov34 homolog, Mov34 protein homolog, MOV3426S proteasome regulatory subunit S12, MOV34L, P40, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog), Proteasome subunit p40, Rpn8, S12 | |
| PSMD7 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title