Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMG3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PSMG3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PSMG3 Polyclonal specifically detects PSMG3 in Human samples. It is validated for Western Blot.Specifications
PSMG3 | |
Polyclonal | |
Rabbit | |
NP_115678 | |
84262 | |
The immunogen for this antibody is PSMG3. Peptide sequence VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C7orf48, hPAC3, MGC10911, PAC-3, PAC3chromosome 7 open reading frame 48, proteasome (prosome, macropain) assembly chaperone 3, proteasome assembling chaperone 3, proteasome assembly chaperone 3 | |
PSMG3 | |
IgG | |
13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title