PSP94/MSMB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233610

Catalog No. NBP233610

Description

PSP94/MSMB Polyclonal specifically detects PSP94/MSMB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Prostate Secretory Protein/PSP
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P08118
• Gene Symbols: MSMB
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 4477
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: beta-microseminoprotein, IGBFProstate secreted seminal plasma protein, immunoglobulin binding factor, Immunoglobulin-binding factor, microseminoprotein, beta-, MSP, MSPB, PN44Prostate secretory protein of 94 amino acids, prostatic secretory protein 94, PRPS, PRSP, PSP, PSP57, PSP94HPC13, PSP-94Seminal plasma beta-inhibin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only