Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSP94/MSMB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Prostate Secretory Protein/PSP |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PSP94/MSMB Polyclonal specifically detects PSP94/MSMB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Prostate Secretory Protein/PSP | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P08118 | |
4477 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Cancer | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
beta-microseminoprotein, IGBFProstate secreted seminal plasma protein, immunoglobulin binding factor, Immunoglobulin-binding factor, microseminoprotein, beta-, MSP, MSPB, PN44Prostate secretory protein of 94 amino acids, prostatic secretory protein 94, PRPS, PRSP, PSP, PSP57, PSP94HPC13, PSP-94Seminal plasma beta-inhibin | |
MSMB | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title