PTDSS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159966

Catalog No. NBP159966

Description

PTDSS1 Polyclonal specifically detects PTDSS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PTDSS1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0024Serine-exchange enzyme I, phosphatidylserine synthase 1, PSS1EC 2.7.8.-, PSSAPSS-1, PtdSer synthase 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9791
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P48651
• Gene Symbols: PTDSS1
• Immunogen: Synthetic peptides corresponding to PTDSS1(phosphatidylserine synthase 1) The peptide sequence was selected from the N terminal of PTDSS1. Peptide sequence MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 90%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Zebrafish
• Isotype: IgG